A5999
LMO4 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A5999
- Zusätzliche Namen:
- LMO4
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 18kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
- Uniprot:
- P61968
- Synonyme:
- breast tumor autoantigen;LIM domain only protein 4;LIM domain transcription factor LMO4;LIM-only 4 protein;LMO-4
- Weitere Details:
- This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene.
- Versandbedingungen:
- Blue Ice