Syntaxin 4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A5996
Zusätzliche Namen:: p35-2|STX4A|Syntaxin 4
Anwendung:: ELISA, WB
Molekulargewicht:: 34 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE
Uniprot:: Q12846
Synonyme:: p35-2;renal carcinoma antigen NY-REN-31;STX4A;syntaxin 4A (placental);syntaxin-4
Weitere Details:: Enables sphingomyelin phosphodiesterase activator activity. Involved in several processes, including cornified envelope assembly; positive regulation of immune effector process; and positive regulation of protein localization. Located in several cellular components, including basolateral plasma membrane; cytoplasmic vesicle; and lamellipodium. Part of SNARE complex. Is active in glutamatergic synapse and postsynapse.