CYP26A1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A5982
Zusätzliche Namen:: CP26|CYP26|CYP26A1|P450RAI|P450RAI1
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 56 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASRFSFIPFGGGLRSCVGKEFAKI
Uniprot:: O43174
Synonyme:: CP26;CYP26;cytochrome P450 26A1;cytochrome P450 retinoic acid-inactivating 1;cytochrome P450, family 26, subfamily A, polypeptide 1;cytochrome P450, subfamily XXVIA, polypeptide 1;cytochrome P450RAI;hP450RAI;P450, retinoic acid-inactivating, 1;P450RAI;P450RAI1;retinoic acid 4-hydroxylase;retinoic acid-metabolizing cytochrome
Weitere Details:: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein acts on retinoids, including all-trans-retinoic acid (RA), with both 4-hydroxylation and 18-hydroxylation activities. This enzyme regulates the cellular level of retinoic acid which is involved in regulation of gene expression in both embryonic and adult tissues. Two alternatively spliced transcript variants of this gene, which encode the distinct isoforms, have been reported.

Versandbedingungen:: Blue Ice