A5978
ERAP1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A5978
- Zusätzliche Namen:
- A-LAP|ALAP|APPILS|ARTS-1|ARTS1|ERAAP|ERAAP1|ERAP1|PILS-AP|PILSAP
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 108kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM
- Uniprot:
- Q9NZ08
- Synonyme:
- A-LAP;adipocyte-derived leucine aminopeptidase;ALAP;aminopeptidase PILS;aminopeptidase regulator of TNFR1 shedding;APPILS;ARTS-1;ARTS1;CTD-2260A17.2;endoplasmic reticulum aminopeptidase 1;endoplasmic reticulum aminopeptidase associated with antigen processing;ERAAP;ERAAP1;PILS-AP;PILSAP;puromycin-insensitive leucyl-specific aminopeptidase;type 1 tumor necrosis factor receptor shedding aminopeptidase regulator
- Weitere Details:
- The protein encoded by this gene is an aminopeptidase involved in trimming HLA class I-binding precursors so that they can be presented on MHC class I molecules. The encoded protein acts as a monomer or as a heterodimer with ERAP2. This protein may also be involved in blood pressure regulation by inactivation of angiotensin II. Three transcript variants encoding two different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice







