PERP Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A5937
Zusätzliche Namen:: dJ496H19.1|EKVP7|KCP1|KRTCAP1|OLMS2|PERP|PIGPC1|THW
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 21kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
Uniprot:: Q96FX8
Synonyme:: 1110017A08Rik;dJ496H19.1;EKVP7;KCP-1;KCP1;keratinocyte-associated protein 1;keratinocytes associated protein 1;KRTCAP1;OLMS2;p53 apoptosis effector related to PMP-22;p53-induced protein PIGPC1;PERP, TP53 apoptosis effector;PIGPC1;THW;transmembrane protein THW
Weitere Details:: Involved in activation of cysteine-type endopeptidase activity. Predicted to be located in plasma membrane. Predicted to be active in cell-cell junction. Implicated in erythrokeratodermia variabilis and mutilating palmoplantar keratoderma with periorificial keratotic plaques.