MTDH Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5887
Zusätzliche Namen:: 3D3|AEG-1|AEG1|LYRIC|LYRIC/3D3|MTDH
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 75kDa/80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYGWAAACAGARKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEAVRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNF
Uniprot:: Q86UE4
Synonyme:: 3D3;3D3/LYRIC;AEG-1;AEG1;astrocyte elevated gene 1;astrocyte elevated gene-1 protein;LYRIC;LYRIC/3D3;lysine-rich CEACAM1 co-isolated protein;Metadherin;metastasis adhesion protein;protein LYRIC
Weitere Details:: Enables NF-kappaB binding activity; double-stranded RNA binding activity; and transcription coactivator activity. Involved in several processes, including lipopolysaccharide-mediated signaling pathway; positive regulation of intracellular signal transduction; and regulation of transcription, DNA-templated. Located in endoplasmic reticulum; nuclear lumen; and perinuclear region of cytoplasm. Implicated in hepatocellular carcinoma.