SF3B2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5875
Zusätzliche Namen:: CFM|Cus1|HFM|SAP145|SF3b1|SF3B145|SF3b150|SF3B2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 140 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF
Uniprot:: Q13435
Synonyme:: Cus1;pre-mRNA splicing factor SF3b 145 kDa subunit;Pre-mRNA-splicing factor SF3b 145 kDa subunit;SAP 145;SAP145;SF3b1;SF3B145;SF3b150;spliceosome associated protein 145;Spliceosome-associated protein 145;splicing factor 3B subunit 2;splicing factor 3b, subunit 2, 145kD;splicing factor 3b, subunit 2, 145kDa
Weitere Details:: This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus.

Versandbedingungen:: Blue Ice