PLZF Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5863
Zusätzliche Namen:: PLZF|ZNF145
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
Uniprot:: Q05516
Synonyme:: PLZF;promyelocytic leukaemia zinc finger;Promyelocytic leukemia zinc finger protein;zinc finger and BTB domain-containing protein 16;Zinc finger protein 145;zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia);zinc finger protein PLZF;ZNF145
Weitere Details:: This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.