A5862
Ku80 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5862
- Zusätzliche Namen:
- KARP-1|KARP1|KU80|Ku86|KUB2|NFIV
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molekulargewicht:
- 86kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
- Uniprot:
- P13010
- Synonyme:
- 86 kDa subunit of Ku antigen;ATP-dependent DNA helicase 2 subunit 2;ATP-dependent DNA helicase II 80 kDa subunit;CTC box-binding factor 85 kDa subunit;CTC85;CTCBF;DNA repair protein XRCC5;KARP-1;KARP1;Ku autoantigen, 80kDa;KU80;Ku86;Ku86 autoantigen related protein 1;KUB2;lupus Ku autoantigen protein p86;NFIV;nuclear factor IV;thyroid-lupus autoantigen;TLAA;X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining);X-ray repair cross-complementing protein 5
- Weitere Details:
- The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.
- Versandbedingungen:
- Blue Ice