A5858
TNFSF13B Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5858
- Zusätzliche Namen:
- BAFF|BLYS|CD257|DTL|TALL-1|TALL1|THANK|TNFSF13B|TNFSF20|TNLG7A|ZTNF4
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 17kDa/31kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQK
- Uniprot:
- Q9Y275
- Synonyme:
- ApoL related ligand TALL-1;B lymphocyte stimulator;B-cell-activating factor;B-lymphocyte stimulator;BAFF;BLYS;CD257;delta BAFF;Delta4 BAFF;dendritic cell-derived TNF-like molecule;DTL;epididymis secretory sperm binding protein;TALL-1;TALL1;THANK;TNF and ApoL-related leukocyte expressed ligand 1;TNF homolog that activates apoptosis;TNF- and APOL-related leukocyte expressed ligand 1;TNFSF20;TNLG7A;tumor necrosis factor (ligand) superfamily, member 13b;tumor necrosis factor (ligand) superfamily, member 20;tumor necrosis factor ligand 7A;tumor necrosis factor ligand superfamily member 13B;tumor necrosis factor superfamily member 13b;tumor necrosis factor-like protein ZTNF4;ZTNF4
- Weitere Details:
- The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. Alternatively spliced transcript variants encoding distinct isoforms have been identified.
- Versandbedingungen:
- Blue Ice