A5825
MBL2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A5825
- Zusätzliche Namen:
- COLEC1|HSMBPC|MBL|MBL2|MBL2D|MBP|MBP-C|MBP1|MBPD
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 26kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
- Uniprot:
- P11226
- Synonyme:
- COLEC1;collectin-1;HSMBPC;mannan-binding lectin;Mannan-binding protein;Mannose-binding lectin;mannose-binding lectin (protein C) 2, soluble (opsonic defect);mannose-binding lectin 2, soluble (opsonic defect);mannose-binding protein C;MBL;MBL2D;MBP;MBP-C;MBP1;MBPD
- Weitere Details:
- This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. This binding activates the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
- Versandbedingungen:
- Blue Ice





_WB_01.jpg)


