KAT7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5823
Zusätzliche Namen:: HBO1|HBOA|KAT7|MYST2|ZC2HC7
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 63kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DSSPVRNLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSL
Uniprot:: O95251
Synonyme:: HBO1;HBOA;histone acetyltransferase binding to ORC1;histone acetyltransferase KAT7;histone acetyltransferase MYST2;K(lysine) acetyltransferase 7;Lysine acetyltransferase 7;MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2;MYST histone acetyltransferase 2;MYST2;ZC2HC7
Weitere Details:: The protein encoded by this gene is part of the multimeric HBO1 complex, which possesses histone H4-specific acetyltransferase activity. This activity is required for functional replication origins and is involved in transcriptional activation of some genes. In both cases, the acetylation of histone H4 helps unfold chromatin so that the DNA can be accessed and replicated or transcribed.