GOT1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5822
Zusätzliche Namen:: AST|AST1|ASTQTL1|cAspAT|cCAT|GIG18|GOT1|SGOT
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ
Uniprot:: P17174
Synonyme:: aspartate aminotransferase 1;aspartate aminotransferase, cytoplasmic;aspartate transaminase 1;AST1;ASTQTL1;cAspAT;cCAT;cysteine aminotransferase, cytoplasmic;cysteine transaminase, cytoplasmic;GIG18;glutamate oxaloacetate transaminase 1;glutamic-oxaloacetic transaminase 1, soluble;growth-inhibiting protein 18;testis secretory sperm-binding protein Li 196a;transaminase A
Weitere Details:: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.