COMP Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5812
Zusätzliche Namen:: COMP|CTS2|EDM1|EPD1|MED|PSACH|THBS5|TSP-5|TSP5
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 110 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSG
Uniprot:: P49747
Synonyme:: cartilage oligomeric matrix protein;cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple);CTS2;EDM1;EPD1;MED;PSACH;pseudoachondroplasia (epiphyseal dysplasia 1, multiple);THBS5;thrombospondin-5;TSP5
Weitere Details:: The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Contraction or expansion of a 5 aa aspartate repeat and other mutations can cause pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED).