BBOX1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5810
Zusätzliche Namen:: BBH|BBOX|BBOX1|G-BBH|gamma-BBH
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 45kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHT
Uniprot:: O75936
Synonyme:: BBH;BBOX;butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1;G-BBH;gamma-BBH;gamma-butyrobetaine dioxygenase;Gamma-butyrobetaine hydroxylase;Gamma-butyrobetaine,2-oxoglutarate dioxygenase;gamma-butyrobetaine,2-oxoglutarate dioxygenase 1
Weitere Details:: This gene encodes gamma butyrobetaine hydroxylase which catalyzes the formation of L-carnitine from gamma-butyrobetaine, the last step in the L-carnitine biosynthetic pathway. Carnitine is essential for the transport of activated fatty acids across the mitochondrial membrane during mitochondrial beta-oxidation.