A5802
GRO alpha Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5802
- Zusätzliche Namen:
- FSP|GRO alpha|GRO1|GROa|MGSA|MGSA-a|NAP-3|SCYB1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 11kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
- Uniprot:
- P09341
- Synonyme:
- C-X-C motif chemokine 1;chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha);fibroblast secretory protein;FSP;GRO-alpha(1-73);GRO1;GRO1 oncogene (melanoma growth stimulating activity, alpha);GRO1 oncogene (melanoma growth-stimulating activity);GROa;growth-regulated alpha protein;melanoma growth stimulating activity, alpha;Melanoma growth stimulatory activity;melanoma growth stimulatory activity alpha;MGSA;MGSA alpha;MGSA-a;NAP-3;neutrophil-activating protein 3;SCYB1
- Weitere Details:
- This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4.
- Versandbedingungen:
- Blue Ice