NR5A2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5766
Zusätzliche Namen:: B1F|B1F2|CPF|FTF|FTZ-F1|FTZ-F1beta|hB1F-2|LRH-1|LRH1|NR5A2
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 61kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA
Uniprot:: O00482
Synonyme:: Alpha-1-fetoprotein transcription factor;B1-binding factor;b1-binding factor, hepatocyte transcription factor which activates enhancer II of hepatitis B virus;B1F;B1F2;CPF;CYP7A promoter-binding factor;fetoprotein-alpha 1 (AFP) transcription factor;FTF;FTZ-F1;FTZ-F1beta;hB1F-2;Hepatocytic transcription factor;hepatocytic transcription factor hB1F-3;liver nuclear receptor homolog-1 variant 2;Liver receptor homolog 1;LRH-1;LRH1;nuclear receptor subfamily 5 group A member 2
Weitere Details:: The protein encoded by this gene is a DNA-binding zinc finger transcription factor and is a member of the fushi tarazu factor-1 subfamily of orphan nuclear receptors. The encoded protein is involved in the expression of genes for hepatitis B virus and cholesterol biosynthesis, and may be an important regulator of embryonic development.

Versandbedingungen:: Blue Ice