A5754
ST6GAL1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5754
- Zusätzliche Namen:
- CDw75|SIAT1|ST6GAL1|ST6GalI|ST6N
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 50-70kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGR
- Uniprot:
- P15907
- Synonyme:
- alpha 2,6-ST 1;B-cell antigen CD75;beta-galactoside alpha-2,6-sialyltransferase 1;CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase;CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1;Sialyltransferase 1;sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase);SIAT1;ST6 beta-galactosamide alpha-2,6-sialyltranferase 1;ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1;ST6Gal I;ST6GalI;ST6N
- Weitere Details:
- This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice