A5731
DDX17 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A5731
- Zusätzliche Namen:
- DDX17|P72|RH70
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 72kDa/82kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQ
- Uniprot:
- Q92841
- Synonyme:
- DEAD (Asp-Glu-Ala-Asp) box helicase 17;DEAD (Asp-Glu-Ala-Asp) box polypeptide 17;DEAD box protein 17;DEAD box protein p72;DEAD box protein p82;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD);P72;probable ATP-dependent RNA helicase DDX17;RH70;RNA-dependent helicase p72
- Weitere Details:
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an ATPase activated by a variety of RNA species, but not by dsDNA. This protein, and that encoded by DDX5 gene, are more closely related to each other than to any other member of the DEAD box family. This gene can encode multiple isoforms due to both alternative splicing and the use of alternative translation initiation codons, including a non-AUG (CUG) start codon.
- Versandbedingungen:
- Blue Ice