FUT2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5721
Zusätzliche Namen:: B12QTL1|FUT2|SE|Se2|SEC2|sej
Anwendung:: ELISA, WB
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGY
Uniprot:: Q10981
Synonyme:: alpha (1,2) fucosyltransferase;alpha(1,2)FT 2;alpha(1,2)FT2;B12QTL1;Fucosyltransferase 2;fucosyltransferase 2 (secretor status included);galactoside 2-alpha-L-fucosyltransferase 2;galactoside 2-L-fucosyltransferase;galactoside alpha-(1,2)-fucosyltransferase 2;GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2;SE;Se2;SEC2;secretor blood group alpha-2-fucosyltransferase;secretor factor;sej;truncated fucosyltransferase 2;type 1 galactoside alpha-(1,2)-fucosyltransferase FUT2;type 2 galactoside alpha-(1,2)-fucosyltransferase FUT2
Weitere Details:: This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. The encoded protein is important for the final step in the soluble ABO blood group antigen synthesis pathway. It is also involved in cell-cell interaction, cell surface expression, and cell proliferation. Mutations in this gene are a cause of the H-Bombay blood group where red blood cells lack the H antigen.

Versandbedingungen:: Blue Ice