[KO Validated] SIRT3 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A5718
Zusätzliche Namen:: SIR2L3|T3
Anwendung:: ELISA, WB
Molekulargewicht:: 28 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Uniprot:: Q9NTG7
Synonyme:: mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase;NAD-dependent deacetylase sirtuin-3, mitochondrial;NAD-dependent protein deacetylase sirtuin-3, mitochondrial;regulatory protein SIR2 homolog 3;silent mating type information regulation 2, S.cerevisiae, homolog 3;sir2-like 3;SIR2-like protein 3;SIR2L3;sirtuin type 3
Weitere Details:: SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent the formation of cancer cells. SIRT3 has far-reaching effects on nuclear gene expression, cancer, cardiovascular disease, neuroprotection, aging, and metabolic control.