A5718
[KO Validated] SIRT3 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A5718
- Zusätzliche Namen:
- SIR2L3|T3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 28 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
- Uniprot:
- Q9NTG7
- Synonyme:
- mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase;NAD-dependent deacetylase sirtuin-3, mitochondrial;NAD-dependent protein deacetylase sirtuin-3, mitochondrial;regulatory protein SIR2 homolog 3;silent mating type information regulation 2, S.cerevisiae, homolog 3;sir2-like 3;SIR2-like protein 3;SIR2L3;sirtuin type 3
- Weitere Details:
- SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent the formation of cancer cells. SIRT3 has far-reaching effects on nuclear gene expression, cancer, cardiovascular disease, neuroprotection, aging, and metabolic control.
- Versandbedingungen:
- Blue Ice
![[KO Validated] SIRT3 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5718/A5718_1.jpg)
![[KO Validated] SIRT3 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5718/A5718_2.jpg)
![[KO Validated] SIRT3 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5718/A5718_N6406(21-22)_WB_01.jpg)
![[KO Validated] SIRT3 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5718/A5718_N6406(21-22)_WB_02.jpg)
![[KO Validated] SIRT3 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5718/A5718_N6406(21-22)_KO-WB_01.jpg)
![[KO Validated] SIRT3 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5718/A5718_E1653_IHC_02.jpg)