A5717
EHHADH Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5717
- Zusätzliche Namen:
- ECHD|EHHADH|FRTS3|L-PBE|LBFP|LBP|MFE1|PBFE
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 79kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVGNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLTGPTLLPGTPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFLSRYRKTHHIEPRTISQDEILERCLYSLINEAFRILGEGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKEWQSLAGSPSSKL
- Uniprot:
- Q08426
- Synonyme:
- 3,2-trans-enoyl-CoA isomerase;ECHD;enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase;enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase;FRTS3;L-3-hydroxyacyl-CoA dehydrogenase;L-bifunctional protein, peroxisomal;L-PBE;LBFP;LBP;MFE1;multifunctional enzyme 1;PBE;PBFE;peroxisomal bifunctional enzyme;peroxisomal enoyl-CoA hydratase
- Weitere Details:
- The protein encoded by this gene is a bifunctional enzyme and is one of the four enzymes of the peroxisomal beta-oxidation pathway. The N-terminal region of the encoded protein contains enoyl-CoA hydratase activity while the C-terminal region contains 3-hydroxyacyl-CoA dehydrogenase activity. Defects in this gene are a cause of peroxisomal disorders such as Zellweger syndrome. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice