Vitamin D Binding protein Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5709
Zusätzliche Namen:: DBP|DBP-maf|DBP/GC|Gc-MAF|GcMAF|GRD3|HEL-S-51|VDB|VDBG|VDBP|Vitamin D Binding protein
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL
Uniprot:: P02774
Synonyme:: DBP;DBP-maf;DBP/GC;epididymis secretory protein Li 51;gc protein-derived macrophage activating factor;gc-globulin;Gc-MAF;GcMAF;GRD3;Group-specific component;group-specific component (vitamin D binding protein);HEL-S-51;VDB;VDBG;VDBP;vitamin D-binding alpha-globulin;vitamin D-binding protein;vitamin D-binding protein-macrophage activating factor
Weitere Details:: The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.