A5671
IL3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5671
- Zusätzliche Namen:
- IL-3|IL3|MCGF|MULTI-CSF
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 17kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
- Uniprot:
- P08700
- Synonyme:
- colony-stimulating factor, multiple;hematopoietic growth factor;IL-3;interleukin-3;Mast cell growth factor;mast-cell growth factor;MCGF;MULTI-CSF;multilineage-colony-stimulating factor;multipotential colony-stimulating factor;P-cell stimulating factor;P-cell-stimulating factor
- Weitere Details:
- The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.
- Versandbedingungen:
- Blue Ice