A5670
HTR2B Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5670
- Zusätzliche Namen:
- 5-HT-2B|5-HT(2B)|5-HT2B|HTR2B
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 54 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSYV
- Uniprot:
- P41595
- Synonyme:
- 5-HT 2B receptor;5-HT-2B;5-HT(2B);5-HT2B;5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled;5-hydroxytryptamine 2B receptor;5-hydroxytryptamine receptor 2B;5-hydroxytryptamine receptor 2B variant b;serotonin receptor 2B
- Weitere Details:
- This gene encodes one of the several different receptors for 5-hydroxytryptamine (serotonin) that belongs to the G-protein coupled receptor 1 family. Serotonin is a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Serotonin receptors mediate many of the central and peripheral physiologic functions of serotonin, including regulation of cardiovascular functions and impulsive behavior. Population and family-based analyses of a minor allele (glutamine-to-stop substitution, designated Q20*) which blocks expression of this protein, and knockout studies in mice, suggest a role for this gene in impulsivity. However, other factors, such as elevated testosterone levels, may also be involved. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice