CD74 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5667
Zusätzliche Namen:: CD74|CLIP|DHLAG|HLADG|Ia-GAMMA|II|p33
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 30-40 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Uniprot:: P04233
Synonyme:: CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated);CD74 molecule, major histocompatibility complex, class II invariant chain;DHLAG;gamma chain of class II antigens;HLA class II histocompatibility antigen gamma chain;HLA-DR antigens-associated invariant chain;HLA-DR-gamma;HLADG;Ia antigen-associated invariant chain;Ia-associated invariant chain;Ia-GAMMA;II;MHC HLA-DR gamma chain;p33
Weitere Details:: The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

Versandbedingungen:: Blue Ice