PIAS2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5654
Zusätzliche Namen:: ARIP3|DIP|MIZ1|PIAS2|PIASX|SIZ2|ZMIZ4
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EDGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDIISLD
Uniprot:: O75928
Synonyme:: androgen receptor-interacting protein 3;ARIP3;DAB2-interacting protein;DIP;E3 SUMO-protein ligase PIAS2;E3 SUMO-protein transferase PIAS2;MIZ1;msx-interacting zinc finger protein;PIAS-NY protein;PIASX;protein inhibitor of activated STAT X;Protein inhibitor of activated STAT2;SIZ2;zinc finger, MIZ-type containing 4;ZMIZ4
Weitere Details:: This gene encodes a member of the protein inhibitor of activated STAT family, which function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Isoforms of the encoded protein enhance the sumoylation of specific target proteins including the p53 tumor suppressor protein, c-Jun, and the androgen receptor. A pseudogene of this gene is located on the short arm of chromosome 4. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1.

Versandbedingungen:: Blue Ice