A5653
OCA2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5653
- Zusätzliche Namen:
- BEY|BEY1|BEY2|BOCA|D15S12|EYCL|EYCL2|EYCL3|HCL3|OCA2|P|PED|SHEP1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 65-80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNSLQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPHIRLRLSKLRRCVQWLKV
- Uniprot:
- Q04671
- Synonyme:
- BEY;BEY1;BEY2;BOCA;D15S12;EYCL;EYCL2;EYCL3;eye color 2 (central brown);eye color 3 (brown);hair color 3 (brown);HCL3;melanocyte-specific transporter protein;oculocutaneous albinism II (pink-eye dilution homolog, mouse);P;P protein;P-protein;PED;pink-eyed dilution protein homolog;SHEP1;total brown iris pigmentation
- Weitere Details:
- This gene encodes the human homolog of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine, which is a precursor to melanin synthesis. It is involved in mammalian pigmentation, where it may control skin color variation and act as a determinant of brown or blue eye color. Mutations in this gene result in type 2 oculocutaneous albinism. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice