A5652
NLRP3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A5652
- Zusätzliche Namen:
- AGTAVPRL|AII|AVP|C1orf7|CIAS1|CLR1.1|DFNA34|FCAS|FCAS1|FCU|KEFH|MWS|NALP3|NLRP3|PYPAF1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 118 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYRKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIKEHRSQQEREQELLAIGKTKTCESPVSPIKMELLFD
- Uniprot:
- Q96P20
- Synonyme:
- AGTAVPRL;AII;Angiotensin/vasopressin receptor AII/AVP-like;AVP;C1orf7;caterpiller protein 1.1;CIAS1;CLR1.1;cold autoinflammatory syndrome 1 protein;cold-induced autoinflammatory syndrome 1 protein;cryopyrin;cryopyrin, NACHT, LRR and PYD domains - containing protein 3;deafness, autosomal dominant 34;DFNA34;FCAS;FCAS1;FCU;KEFH;MWS;NACHT domain-, leucine-rich repeat-, and PYD-containing protein 3;NACHT, LRR and PYD containing protein 3;NACHT, LRR and PYD domains-containing protein 3;NALP3;nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 3;PYPAF1;PYRIN-containing APAF1-like protein 1
- Weitere Details:
- This gene encodes a pyrin-like protein containing a pyrin domain, a nucleotide-binding site (NBS) domain, and a leucine-rich repeat (LRR) motif. This protein interacts with the apoptosis-associated speck-like protein PYCARD/ASC, which contains a caspase recruitment domain, and is a member of the NLRP3 inflammasome complex. This complex functions as an upstream activator of NF-kappaB signaling, and it plays a role in the regulation of inflammation, the immune response, and apoptosis. The SARS-CoV 3a protein, a transmembrane pore-forming viroporin, has been shown to activate the NLRP3 inflammasome via the formation of ion channels in macrophages. Mutations in this gene are associated with familial cold autoinflammatory syndrome (FCAS), Muckle-Wells syndrome (MWS), chronic infantile neurological cutaneous and articular (CINCA) syndrome, neonatal-onset multisystem inflammatory disease (NOMID), keratoendotheliitis fugax hereditarian, and deafness, autosomal dominant 34, with or without inflammation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Alternative 5' UTR structures are suggested by available data; however, insufficient evidence is available to determine if all of the represented 5' UTR splice patterns are biologically valid.
- Versandbedingungen:
- Blue Ice


_WB_01.jpg)
_IF_01.jpg)