NKX2-5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5651
Zusätzliche Namen:: CHNG5|CSX|CSX1|HLHS2|NKX2-5|NKX2.5|NKX2E|NKX4-1|VSD3
Anwendung:: ELISA, WB
Molekulargewicht:: 37kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRA
Uniprot:: P52952
Synonyme:: Cardiac-specific homeobox;cardiac-specific homeobox 1;CHNG5;CSX;CSX1;HLHS2;homeobox protein CSX;homeobox protein NK-2 homolog E;homeobox protein NKX 2-5;homeobox protein Nkx-2.5;NK2 transcription factor related, locus 5;NKX 2-5;NKX2.5;NKX2E;NKX4-1;tinman homolog;tinman paralog;VSD3
Weitere Details:: This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants.