A5648
IFNL3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A5648
- Zusätzliche Namen:
- IFN-lambda-3|IFN-lambda-4|IFNL3|IL-28B|IL-28C|IL28B|IL28C
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 24kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELAL
- Uniprot:
- Q8IZI9
- Synonyme:
- cytokine Zcyto22;IFN-lambda-3;IFN-lambda-4;IL-28B;IL-28C;IL28B;IL28C;interferon lambda-3;interferon, lambda 4;interleukin-28B;interleukin-28C
- Weitere Details:
- This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
- Versandbedingungen:
- Blue Ice

