CREM Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5624
Zusätzliche Namen:: CREM|CREM-2|hCREM-2|ICER
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 39kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSKCARKKYIKTNPRQMTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVP
Uniprot:: Q03060
Synonyme:: cAMP response element modulator;cAMP-responsive element modulator;CREM 2alpha-b protein;CREM 2beta-a protein;CREM-2;hCREM-2;ICER;Inducible cAMP early repressor;inducible cAMP early repressor ICER
Weitere Details:: This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription.