A5609
VEGF Receptor 2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5609
- Zusätzliche Namen:
- CD309|FLK1|VEGF Receptor 2|VEGFR|VEGFR2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 210kDa/230kDa/230kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVK
- Uniprot:
- P35968
- Synonyme:
- CD309;Fetal liver kinase 1;fetal liver kinase-1;FLK1;Kinase insert domain receptor;kinase insert domain receptor (a type III receptor tyrosine kinase);protein-tyrosine kinase receptor Flk-1;soluble VEGFR2;tyrosine kinase growth factor receptor;vascular endothelial growth factor receptor 2;VEGFR;VEGFR2
- Weitere Details:
- Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. The signalling and trafficking of this receptor are regulated by multiple factors, including Rab GTPase, P2Y purine nucleotide receptor, integrin alphaVbeta3, T-cell protein tyrosine phosphatase, etc.. Mutations of this gene are implicated in infantile capillary hemangiomas.
- Versandbedingungen:
- Blue Ice