A5599
TWIST2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A5599
- Zusätzliche Namen:
- AMS|BBRSAY|bHLHa39|DERMO1|FFDD3|SETLSS|TWIST2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 18kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK
- Uniprot:
- Q8WVJ9
- Synonyme:
- AMS;BBRSAY;bHLHa39;class A basic helix-loop-helix protein 39;dermis-expressed protein 1;DERMO1;FFDD3;SETLSS;twist basic helix-loop-helix transcription factor 2;twist homolog 2;twist-related bHLH protein Dermo1;twist-related protein 2
- Weitere Details:
- The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found.
- Versandbedingungen:
- Blue Ice

