A5594
NAPSA Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A5594
- Zusätzliche Namen:
- KAP|Kdap|NAP1|NAPA|NAPSA|SNAPA
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 38kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
- Uniprot:
- O96009
- Synonyme:
- asp 4;ASP4;aspartyl protease 4;KAP;Kdap;kidney-derived aspartic protease-like protein;NAP1;NAPA;napsin-1;napsin-A;pronapsin A;SNAPA;TA01/TA02
- Weitere Details:
- This gene encodes a member of the peptidase A1 family of aspartic proteases. The encoded preproprotein is proteolytically processed to generate an activation peptide and the mature protease. The activation peptides of aspartic proteinases function as inhibitors of the protease active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The encoded protease may play a role in the proteolytic processing of pulmonary surfactant protein B in the lung and may function in protein catabolism in the renal proximal tubules. This gene has been described as a marker for lung adenocarcinoma and renal cell carcinoma.
- Versandbedingungen:
- Blue Ice







