A5592
THRA Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A5592
- Zusätzliche Namen:
- AR7|c-erbA|c-ERBA-1|CHNG6|EAR7|ERB-T-1|ERBA|ERBA1|NR1A1|THRA|THRA1|THRA2|THRalpha|THRalpha1|THRalpha2|TRalpha|TRalpha1|TRalpha2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- IEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
- Uniprot:
- P10827
- Synonyme:
- AR7;c-ERBA-1;c-erbA-alpha;CHNG6;EAR-7;EAR7;ERB-T-1;ERBA;ERBA-related 7;ERBA1;NR1A1;nuclear receptor subfamily 1 group A member 1;THRA1;THRA2;thyroid hormone receptor alpha;thyroid hormone receptor alpha 1;thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian);thyroid normone nuclear receptor alpha variant 1;TRalpha;triiodothyronine receptor;V-erbA-related protein 7
- Weitere Details:
- The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Versandbedingungen:
- Blue Ice



