A5580
HSPE1/HSP10/CPN10 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A5580
- Zusätzliche Namen:
- CPN10|EPF|GROES|HSP10|HSPE1/HSP10/CPN10
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 11kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
- Uniprot:
- P61604
- Synonyme:
- 10 kDa chaperonin;10 kDa heat shock protein, mitochondrial;chaperonin 10;CPN10;early-pregnancy factor;EPF;epididymis secretory sperm binding protein;GROES;heat shock 10kD protein 1 (chaperonin 10);heat shock 10kDa protein 1;HSP10
- Weitere Details:
- This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.
- Versandbedingungen:
- Blue Ice