A5559
ATIC Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5559
- Zusätzliche Namen:
- AICAR|AICARFT|ATIC|HEL-S-70p|IMPCHASE|PURH
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 62kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPIS
- Uniprot:
- P31939
- Synonyme:
- 5-aminoimidazole-4-carboxamide-1-beta-D-ribonucleotide transformylase/inosinicase;AICAR;AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme;AICAR transformylase/inosine monophosphate cyclohydrolase;AICARFT;AICARFT/IMPCHASE;bifunctional purine biosynthesis protein ATIC;bifunctional purine biosynthesis protein PURH;epididymis secretory sperm binding protein Li 70p;HEL-S-70p;IMPCHASE;phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase;PURH
- Weitere Details:
- This gene encodes a bifunctional protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-terminal domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-terminal domain has IMP cyclohydrolase activity. A mutation in this gene results in AICA-ribosiduria.
- Versandbedingungen:
- Blue Ice