A5548
[KO Validated] CDK8 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A5548
- Zusätzliche Namen:
- IDDHBA|K35|K8
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 56kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
- Uniprot:
- P49336
- Synonyme:
- CDK8 protein kinase;cell division protein kinase 8;cyclin-dependent kinase 8;IDDHBA;K35;mediator complex subunit CDK8;mediator of RNA polymerase II transcription subunit CDK8;protein kinase K35
- Weitere Details:
- This gene encodes a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit, cyclin C, are components of the Mediator transcriptional regulatory complex, involved in both transcriptional activation and repression by phosphorylation of the carboxy-terminal domain of the largest subunit of RNA polymerase II. This kinase regulates transcription by targeting the cyclin-dependent kinase 7 subunits of the general transcription initiation factor IIH, thus providing a link between the Mediator complex and the basal transcription machinery. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice
![[KO Validated] CDK8 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5548/A5548_1.jpg)
![[KO Validated] CDK8 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5548/A5548_2.jpg)
![[KO Validated] CDK8 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5548/A5548_3.jpg)
![[KO Validated] CDK8 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5548/A5548_P5000_WB_01.jpg)
![[KO Validated] CDK8 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5548/A5548_P5000_KO-WB_01.jpg)
![[KO Validated] CDK8 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5548/A5548_P5000_IP_01.jpg)