SULT2A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5489
Zusätzliche Namen:: DHEA-ST|DHEA-ST8|DHEAS|HST|hSTa|ST2|ST2A1|ST2A3|STD|SULT2A1|SULT2A3
Anwendung:: ELISA, WB
Molekulargewicht:: 34kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKS
Uniprot:: Q06520
Synonyme:: alcohol/hydroxysteroid sulfotransferase;bile-salt sulfotranasferase 2A1;Dehydroepiandrosterone sulfotransferase;DHEA-ST;DHEA-ST8;DHEAS;HST;hSTa;Hydroxysteroid Sulfotransferase;ST2;ST2A1;ST2A3;STD;sulfotransferase 2A1;sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1;SULT2A3
Weitere Details:: This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome.