A5485
RFC4 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5485
- Zusätzliche Namen:
- A1|RFC37|RFC4
- Anwendung:
- ELISA, WB, IF, ICC, IP
- Molekulargewicht:
- 40 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC
- Uniprot:
- P35249
- Synonyme:
- A1;A1 37 kDa subunit;activator 1 37 kDa subunit;activator 1 subunit 4;replication factor C (activator 1) 4, 37kDa;replication factor C 37 kDa subunit;replication factor C subunit 4;RF-C 37 kDa subunit;RFC 37 kDa subunit;RFC37
- Weitere Details:
- The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported.
- Versandbedingungen:
- Blue Ice