A5469
[KO Validated] LITAF Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A5469
- Zusätzliche Namen:
- AF|PIG7|SIMPLE|TP53I7
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 23kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
- Uniprot:
- Q99732
- Synonyme:
- lipopolysaccharide-induced TNF-alpha factor;lipopolysaccharide-induced tumor necrosis factor-alpha factor;LPS-induced TNF-alpha factor;p53-induced gene 7 protein;PIG7;SIMPLE;small integral membrane protein of lysosome/late endosome;TP53I7;tumor protein p53 inducible protein 7
- Weitere Details:
- Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice
![[KO Validated] LITAF Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5469/A5469_1.jpg)
![[KO Validated] LITAF Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5469/A5469_2.jpg)
![[KO Validated] LITAF Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5469/A5469_3.jpg)
![[KO Validated] LITAF Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5469/A5469_P1018_KO-WB_01.jpg)
![[KO Validated] LITAF Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5469/A5469_N25216-4_WB_01.jpg)
![[KO Validated] LITAF Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A5469/A5469_P1018_IHC_01.jpg)