A5462
GDI1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5462
- Zusätzliche Namen:
- 1A|GDI1|GDIL|MRX41|MRX48|OPHN2|RABGD1A|RABGDIA|XAP-4|XLID41
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ALALYRTDDYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ
- Uniprot:
- P31150
- Synonyme:
- 1A;GDI-1;GDIL;guanosine diphosphate dissociation inhibitor 1;mental retardation, X-linked 48;MRX41;MRX48;oligophrenin-2;OPHN2;protein XAP-4;rab GDI alpha;rab GDP dissociation inhibitor alpha;rab GDP-dissociation inhibitor, alpha;RABGD1A;RABGDIA;testis secretory sperm-binding protein Li 208a;XAP-4;XLID41
- Weitere Details:
- GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI1 is expressed primarily in neural and sensory tissues. Mutations in GDI1 have been linked to X-linked nonspecific cognitive disability.
- Versandbedingungen:
- Blue Ice