A5458
CPE Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A5458
- Zusätzliche Namen:
- BDVS|CPE|CPH|IDDHH
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 53-55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYKLTASAPGYLAITKKVAVPYSPAAGVDFELESFSERKEEEKEELMEWWKMMSETLNF
- Uniprot:
- P16870
- Synonyme:
- carbocypeptidase E;carboxypeptidase E;carboxypeptidase H;cobalt-stimulated chromaffin granule carboxypeptidase;CPH;enkephalin convertase;epididymis secretory sperm binding protein;IDDHH;insulin granule-associated carboxypeptidase;prohormone-processing carboxypeptidase
- Weitere Details:
- This gene encodes a member of the M14 family of metallocarboxypeptidases. The encoded preproprotein is proteolytically processed to generate the mature peptidase. This peripheral membrane protein cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. This protein may also function independently of its peptidase activity, as a neurotrophic factor that promotes neuronal survival, and as a sorting receptor that binds to regulated secretory pathway proteins, including prohormones. Mutations in this gene are implicated in type 2 diabetes.
- Versandbedingungen:
- Blue Ice

