CDC34 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5457
Zusätzliche Namen:: CDC34|E2-CDC34|UBC3|UBCH3|UBE2R1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 32kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
Uniprot:: P49427
Synonyme:: (E3-independent) E2 ubiquitin-conjugating enzyme R1;cell division cycle 34 homolog;E2 ubiquitin-conjugating enzyme R1;E2-CDC34;UBC3;UBCH3;UBE2R1;ubiquitin carrier protein;ubiquitin-conjugating enzyme E2 R1;ubiquitin-conjugating enzyme E2-32 KDA complementing;ubiquitin-conjugating enzyme E2-CDC34;ubiquitin-protein ligase R1
Weitere Details:: The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication.