PSMB10 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5452
Zusätzliche Namen:: beta2i|LMP10|MECL1|PRAAS5|PSMB10
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 29kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Uniprot:: P40306
Synonyme:: beta2i;LMP10;low molecular mass protein 10;macropain subunit MECl-1;MECL1;multicatalytic endopeptidase complex subunit MECl-1;PRAAS5;proteasome (prosome, macropain) subunit, beta type, 10;proteasome catalytic subunit 2i;proteasome MECl-1;proteasome subunit beta 10;proteasome subunit beta 7i;proteasome subunit beta type-10;proteasome subunit beta-2i;proteasome subunit beta2i;proteasome subunit MECL1
Weitere Details:: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome.

Versandbedingungen:: Blue Ice