A5452
PSMB10 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A5452
- Zusätzliche Namen:
- beta2i|LMP10|MECL1|PRAAS5|PSMB10
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 29kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
- Uniprot:
- P40306
- Synonyme:
- beta2i;LMP10;low molecular mass protein 10;macropain subunit MECl-1;MECL1;multicatalytic endopeptidase complex subunit MECl-1;PRAAS5;proteasome (prosome, macropain) subunit, beta type, 10;proteasome catalytic subunit 2i;proteasome MECl-1;proteasome subunit beta 10;proteasome subunit beta 7i;proteasome subunit beta type-10;proteasome subunit beta-2i;proteasome subunit beta2i;proteasome subunit MECL1
- Weitere Details:
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome.
- Versandbedingungen:
- Blue Ice







