CRABP1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A5434
Zusätzliche Namen:: CRABP|CRABP-I|CRABP1|CRABPI|RBP5
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 16kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE
Uniprot:: P29762
Synonyme:: cellular retinoic acid-binding protein 1;cellular retinoic acid-binding protein I;CRABP;CRABP-I;CRABPI;RBP5
Weitere Details:: This gene encodes a specific binding protein for a vitamin A family member and is thought to play an important role in retinoic acid-mediated differentiation and proliferation processes. It is structurally similar to the cellular retinol-binding proteins, but binds only retinoic acid at specific sites within the nucleus, which may contribute to vitamin A-directed differentiation in epithelial tissue.