JunD Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A5433
Zusätzliche Namen:: AP-1|JunD
Anwendung:: ChIP, ELISA, WB, FuncS
Molekulargewicht:: 38 kDa/42 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSY
Uniprot:: P17535
Synonyme:: activator protein 1;AP-1;jun D proto-oncogene;transcription factor jun-D
Weitere Details:: The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms (PMID:12105216).