A5373
GFRA1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A5373
- Zusätzliche Namen:
- GDNFR|GDNFR-alpha-1|GDNFRA|GFR-ALPHA-1|GFRA1|GFRalpha-1|RET1L|RETL1|RHDA4|TRNR1
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FGNGSDVTVWQPAFPVQTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGNY
- Uniprot:
- P56159
- Synonyme:
- GDNF family receptor alpha-1;GDNF receptor alpha 1d;GDNF receptor alpha 1e;GDNFR;GDNFR-alpha-1;GDNFRA;GFR-ALPHA-1;GFRalpha-1;Glial cell line-derived neurotrophic factor receptor alpha;GPI-linked anchor protein;PI-linked cell-surface accessory protein;RET ligand 1;RET1L;RETL1;TGF-beta-related neurotrophic factor receptor 1;TRNR1
- Weitere Details:
- This gene encodes a member of the glial cell line-derived neurotrophic factor receptor (GDNFR) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature receptor. Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. This receptor is a glycosylphosphatidylinositol (GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.
- Versandbedingungen:
- Blue Ice








