A5368
CTSH Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A5368
- Zusätzliche Namen:
- ACC-4|ACC-5|ACC4|ACC5|CPSB|CTSH
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 41kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGS
- Uniprot:
- P09668
- Synonyme:
- ACC-4;ACC-5;ACC4;ACC5;aleurain;cathepsin B3;cathepsin BA;CPSB;N-benzoylarginine-beta-naphthylamide hydrolase;pro-cathepsin H
- Weitere Details:
- The protein encoded by this gene is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. The encoded protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice

